PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_32855-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 517aa    MW: 55518.3 Da    PI: 6.9817
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_32855-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.43.2e-38140200262
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      ++k+l+cprC+s++tkfCyynny+++qPr+fC++C+ryWt+GG++rn+PvG+grrk+k+ss
  TRIUR3_32855-P1 140 PDKILPCPRCNSMDTKFCYYNNYNIHQPRHFCRGCQRYWTAGGSMRNLPVGAGRRKSKSSS 200
                      7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-29137197IPR003851Zinc finger, Dof-type
PfamPF027013.0E-31142198IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.127144198IPR003851Zinc finger, Dof-type
PROSITE patternPS013610146182IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MELAGAAHPQ PPESDVAPPR TPPQAPAEIL VRLFKLAASY KVEHRYRDDV CQLIIARFAY  60
HTVHGQDSCK DTGDTRITEE NSCTPPDLNL SQPNNSGLNS SSACENQTSN GDEMTEPEST  120
LEAAKTEGDG SNKEKVLKKP DKILPCPRCN SMDTKFCYYN NYNIHQPRHF CRGCQRYWTA  180
GGSMRNLPVG AGRRKSKSSS TNCNGILIPG GSLSAPGGDA SVIPLPIKEN QPAVKFGSDS  240
TLPNSMASLL RVEEQNKNSN PASTAHPRNG ENQTCPPSAT TSDNPRIESV KVAVGVHQNG  300
ITGDCNGVTP MPPIPCFPGA PFMYPWNPAW NGVPAMAAPV CPVPAEPANC SENGHGGNIQ  360
WNFPPMVPMP GFCGPPIPFP VMPPSIWPLV SPWPNGAWSA PWLGPAYNMS AAPPTSSSTC  420
SDSGSPVLGK HPRDSEPRGG EKAERSLWIP KTLRIDDPDE AAKSSIWTTL GIEPGERGMF  480
RAFQPKSGGR EQMSNAARVM QANPAAQSRF ASFQETT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3588050.0AK358805.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1083I10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233788.10.0PREDICTED: cyclic dof factor 1-like
TrEMBLM7ZFZ80.0M7ZFZ8_TRIUA; Dof zinc finger protein DOF5.2
STRINGMLOC_19593.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.24e-69cycling DOF factor 2